Lineage for d1e6jp1 (1e6j P:148-220)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487604Protein HIV capsid protein, dimerisation domain [47359] (1 species)
  7. 1487605Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (14 PDB entries)
  8. 1487622Domain d1e6jp1: 1e6j P:148-220 [16956]
    Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp2

Details for d1e6jp1

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
PDB Compounds: (P:) capsid protein p24

SCOPe Domain Sequences for d1e6jp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jp1 a.28.3.1 (P:148-220) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
aatleemmtacqg

SCOPe Domain Coordinates for d1e6jp1:

Click to download the PDB-style file with coordinates for d1e6jp1.
(The format of our PDB-style files is described here.)

Timeline for d1e6jp1: