Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (141 PDB entries) |
Domain d2wpms_: 2wpm S: [169552] Other proteins in same PDB: d2wpme_ automated match to d1rfna_ complexed with ca; mutant |
PDB Entry: 2wpm (more details), 2 Å
SCOPe Domain Sequences for d2wpms_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wpms_ b.47.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl kfgsgyvsgwgrvfhkgraalvlqylrvplvdratclrstkftitnnmfcagfheggrds cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
Timeline for d2wpms_: