Lineage for d1a43__ (1a43 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) Superfamily a.28.3: Retrovirus capsid protein C-terminal domain [47353] (1 family) 
Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (4 proteins) Protein HIV capsid protein, dimerisation domain [47359] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (5 PDB entries) 
Domain d1a43__: 1a43 - [16955]
Details for d1a43__
PDB Entry: 1a43 (more details), 2.6 Å
PDB Description: structure of the hiv-1 capsid protein dimerization domain at 2.6a resolution
SCOP Domain Sequences for d1a43__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a43__ a.28.3.1 (-) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq
SCOP Domain Coordinates for d1a43__:
Click to download the PDB-style file with coordinates for d1a43__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a43__:
- d1a43__ appears in SCOP 1.57
- d1a43__ appears in the current release, SCOPe 2.08, called d1a43a_
View in 3D