Lineage for d2wpjs_ (2wpj S:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319957Protein automated matches [190044] (14 species)
    not a true protein
  7. 1319996Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries)
  8. 1320021Domain d2wpjs_: 2wpj S: [169546]
    Other proteins in same PDB: d2wpje_
    automated match to d1rfna_
    complexed with ca; mutant

Details for d2wpjs_

PDB Entry: 2wpj (more details), 1.6 Å

PDB Description: factor ixa superactive triple mutant, nacl-soaked
PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpjs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpjs_ b.47.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d2wpjs_:

Click to download the PDB-style file with coordinates for d2wpjs_.
(The format of our PDB-style files is described here.)

Timeline for d2wpjs_: