SCOPe 2.01: Domain d2woua_: 2wou A:

Lineage for d2woua_ (2wou A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Type I TGF-beta receptor R4 [56144] (1 species)
   TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases

7. Species Human (Homo sapiens) [TaxId:9606] [56145] (8 PDB entries)
   Uniprot P36897 200-500 ! Uniprot P36897 201-503

8. Domain d2woua_: 2wou A: [169533]
   automated match to d1vjya_
   complexed with edo, zzf

Details for d2woua_

PDB Entry: 2wou, 2.3 Å

PDB Description: alk5 in complex with 4-((4-((2,6-dimethyl-3-pyridyl)oxy)-2-pyridyl) amino)benzenesulfonamide

PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d2woua_:

Sequence; same for both SEQRES and ATOM records:

>d2woua_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls

Timeline for d2woua_:

• d2woua_ is new in SCOPe 2.01-stable
  
• d2woua_ appears in SCOPe 2.02
  
• d2woua_ appears in the current release, SCOPe 2.08, called d2woua1