Lineage for d2wota_ (2wot A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673851Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 1673852Species Human (Homo sapiens) [TaxId:9606] [56145] (10 PDB entries)
    Uniprot P36897 200-500 ! Uniprot P36897 201-503
  8. 1673855Domain d2wota_: 2wot A: [169532]
    automated match to d1vjya_
    complexed with edo, zzg

Details for d2wota_

PDB Entry: 2wot (more details), 1.85 Å

PDB Description: alk5 in complex with 4-((5,6-dimethyl-2-(2-pyridyl)-3-pyridyl)oxy)-n- (3,4,5-trimethoxyphenyl)pyridin-2-amine
PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d2wota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wota_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
qeg

SCOPe Domain Coordinates for d2wota_:

Click to download the PDB-style file with coordinates for d2wota_.
(The format of our PDB-style files is described here.)

Timeline for d2wota_: