Lineage for d2wo9c_ (2wo9 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212397Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1212518Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 1212519Species Human (Homo sapiens) [TaxId:9606] [69781] (33 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 1212530Domain d2wo9c_: 2wo9 C: [169516]
    automated match to d1os2a_
    complexed with 023, 068, ca, gol, so4, zn

Details for d2wo9c_

PDB Entry: 2wo9 (more details), 1.7 Å

PDB Description: mmp12 complex with a beta hydroxy carboxylic acid
PDB Compounds: (C:) Macrophage metalloelastase

SCOPe Domain Sequences for d2wo9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo9c_ d.92.1.11 (C:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOPe Domain Coordinates for d2wo9c_:

Click to download the PDB-style file with coordinates for d2wo9c_.
(The format of our PDB-style files is described here.)

Timeline for d2wo9c_: