Class b: All beta proteins [48724] (177 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein automated matches [190204] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186956] (11 PDB entries) |
Domain d2wnue_: 2wnu E: [169488] Other proteins in same PDB: d2wnua_, d2wnuc_, d2wnud_, d2wnuf_ automated match to d1pk6b_ complexed with nag |
PDB Entry: 2wnu (more details), 2.3 Å
SCOPe Domain Sequences for d2wnue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnue_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega nsifsgfllfpdm
Timeline for d2wnue_: