Lineage for d2wnpf_ (2wnp F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002936Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 3002937Protein automated matches [190726] (1 species)
    not a true protein
  7. 3002938Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries)
  8. 3002939Domain d2wnpf_: 2wnp F: [169481]
    automated match to d1jc9a_
    complexed with ca, ipa; mutant

Details for d2wnpf_

PDB Entry: 2wnp (more details), 1.21 Å

PDB Description: m-ficolin mutant y271f
PDB Compounds: (F:) ficolin-1

SCOPe Domain Sequences for d2wnpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnpf_ d.171.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scatgprnckdlldrgyflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrmdgsvdfy
rdwaaykqgfgsqlgefwlgndnihaltaqgsselrvdlvdfegnhqfakyksfkvadea
ekyklvlgafvggsagnsltghnnnffstkdqdndvsssncaekfqgawwyadchasnln
glylmgphesfanginwsaakgykysykvsemkvrpa

SCOPe Domain Coordinates for d2wnpf_:

Click to download the PDB-style file with coordinates for d2wnpf_.
(The format of our PDB-style files is described here.)

Timeline for d2wnpf_: