Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (24 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [189445] (1 PDB entry) |
Domain d2wlbb_: 2wlb B: [169432] automated match to d1ayfa_ complexed with fes |
PDB Entry: 2wlb (more details), 2.6 Å
SCOPe Domain Sequences for d2wlbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wlbb_ d.15.4.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} gikvffvtpegreimiegnegdsildlahannidlegacegsvacstchvivdpehyell dppeedeedmldlafgleetsrlgcqvllrkdldgirvrip
Timeline for d2wlbb_: