SCOPe 2.08: Domain d2wlbb_: 2wlb B:

Lineage for d2wlbb_ (2wlb B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [189445] (1 PDB entry)

8. Domain d2wlbb_: 2wlb B: [169432]
   automated match to d1ayfa_
   complexed with fes

Details for d2wlbb_

PDB Entry: 2wlb, 2.6 Å

PDB Description: adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria

PDB Compounds: (B:) electron transfer protein 1, mitochondrial

SCOPe Domain Sequences for d2wlbb_:

Sequence; same for both SEQRES and ATOM records:

>d2wlbb_ d.15.4.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
gikvffvtpegreimiegnegdsildlahannidlegacegsvacstchvivdpehyell
dppeedeedmldlafgleetsrlgcqvllrkdldgirvrip

Timeline for d2wlbb_:

• d2wlbb_ first appeared in SCOPe 2.01
  
• d2wlbb_ appears in SCOPe 2.07