Lineage for d1imz__ (1imz -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96939Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
  4. 96963Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 96964Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 96974Protein ImmE8 (Im8) [47349] (1 species)
  7. 96975Species Escherichia coli [TaxId:562] [47350] (2 PDB entries)
  8. 96977Domain d1imz__: 1imz - [16943]

Details for d1imz__

PDB Entry: 1imz (more details)

PDB Description: colicin e8 immunity protein im8, nmr, minimized average structure

SCOP Domain Sequences for d1imz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imz__ a.28.2.1 (-) ImmE8 (Im8) {Escherichia coli}
melknsisdytetefkkiiediincegdekkqddnlehfisvtehpsgsdliyypegnnd
gspeavikeikewraangksgfkqg

SCOP Domain Coordinates for d1imz__:

Click to download the PDB-style file with coordinates for d1imz__.
(The format of our PDB-style files is described here.)

Timeline for d1imz__: