Lineage for d2wk0a_ (2wk0 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244965Protein automated matches [190161] (23 species)
    not a true protein
  7. 2244968Species Bacillus licheniformis [TaxId:1402] [188244] (15 PDB entries)
  8. 2244972Domain d2wk0a_: 2wk0 A: [169392]
    automated match to d1i2wb_
    complexed with biy, cit, cl, eoh, so4

Details for d2wk0a_

PDB Entry: 2wk0 (more details), 1.65 Å

PDB Description: crystal structure of the class a beta-lactamase bs3 inhibited by 6-beta-iodopenicillanate.
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2wk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk0a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkaln

SCOPe Domain Coordinates for d2wk0a_:

Click to download the PDB-style file with coordinates for d2wk0a_.
(The format of our PDB-style files is described here.)

Timeline for d2wk0a_: