SCOPe 2.06: Domain d2wjmm_: 2wjm M:

Lineage for d2wjmm_ (2wjm M:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (9 species)
   not a true protein

7. Species Rhodopseudomonas viridis [TaxId:1079] [189054] (2 PDB entries)

8. Domain d2wjmm_: 2wjm M: [169382]
   Other proteins in same PDB: d2wjmc_, d2wjmh1, d2wjmh2
   automated match to d1dxrm_
   complexed with bcb, bpb, dga, fe2, hem, mpg, mq7, ns5, po4

Details for d2wjmm_

PDB Entry: 2wjm, 1.95 Å

PDB Description: lipidic sponge phase crystal structure of the photosynthetic reaction centre from blastochloris viridis (low dose)

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2wjmm_:

Sequence; same for both SEQRES and ATOM records:

>d2wjmm_ f.26.1.1 (M:) automated matches {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d2wjmm_:

• d2wjmm_ first appeared in SCOPe 2.01
  
• d2wjmm_ appears in SCOPe 2.05
  
• d2wjmm_ appears in SCOPe 2.07
  
• d2wjmm_ appears in the current release, SCOPe 2.08