SCOPe 2.06: Domain d2whea_: 2whe A:

Lineage for d2whea_ (2whe A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein beta-Phosphoglucomutase [75174] (3 species)

7. Species Lactococcus lactis [TaxId:1358] [75175] (17 PDB entries)

8. Domain d2whea_: 2whe A: [169349]
   automated match to d1lvha_
   complexed with mg

Details for d2whea_

PDB Entry: 2whe, 1.55 Å

PDB Description: structure of native beta-phosphoglucomutase in an open conformation without bound ligands.

PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d2whea_:

Sequence; same for both SEQRES and ATOM records:

>d2whea_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

Timeline for d2whea_:

• d2whea_ first appeared in SCOPe 2.01
  
• d2whea_ appears in SCOPe 2.05
  
• d2whea_ appears in SCOPe 2.07
  
• d2whea_ appears in the current release, SCOPe 2.08