Lineage for d2wgra_ (2wgr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879229Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)
  8. 2879235Domain d2wgra_: 2wgr A: [169328]
    automated match to d2f8aa1
    complexed with pop

Details for d2wgra_

PDB Entry: 2wgr (more details), 1.7 Å

PDB Description: Combining crystallography and molecular dynamics: The case of Schistosoma mansoni phospholipid glutathione peroxidase
PDB Compounds: (A:) glutathione peroxidase

SCOPe Domain Sequences for d2wgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgra_ c.47.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
swnsiyeftvkdingvdvslekyrghvclivnvacksgatdknyrqlqemhtrlvgkglr
ilafpcnqfggqepwaeaeikkfvtekygvqfdmfskikvngsdaddlykflksrqhgtl
tnnikwnfskflvdrqgqpvkryspttapydiegdimellekk

SCOPe Domain Coordinates for d2wgra_:

Click to download the PDB-style file with coordinates for d2wgra_.
(The format of our PDB-style files is described here.)

Timeline for d2wgra_: