Lineage for d2wfba_ (2wfb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1608074Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 1608090Family c.55.5.0: automated matches [191524] (1 protein)
    not a true family
  6. 1608091Protein automated matches [190882] (2 species)
    not a true protein
  7. 1608092Species Desulfovibrio gigas [TaxId:879] [189348] (1 PDB entry)
  8. 1608093Domain d2wfba_: 2wfb A: [169300]
    automated match to d1rdua_
    complexed with act, po4

Details for d2wfba_

PDB Entry: 2wfb (more details), 2 Å

PDB Description: high resolution structure of the apo form of the orange protein (orp) from desulfovibrio gigas
PDB Compounds: (A:) putative uncharacterized protein orp

SCOPe Domain Sequences for d2wfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wfba_ c.55.5.0 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
ashmqriavtaegpgldglvdprfgraagfvvvdaatmaaeyvdngasqtlshgaginaa
qvlaksgagvlltgyvgpkafqalqaagikvgqdlegltvrqavqrfldgqvpmaagpnk

SCOPe Domain Coordinates for d2wfba_:

Click to download the PDB-style file with coordinates for d2wfba_.
(The format of our PDB-style files is described here.)

Timeline for d2wfba_: