SCOPe 2.08: Domain d2wfba1: 2wfb A:4-120

Lineage for d2wfba1 (2wfb A:4-120)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families)

5. Family c.55.5.0: automated matches [191524] (1 protein)
   not a true family

6. Protein automated matches [190882] (2 species)
   not a true protein

7. Species Desulfovibrio gigas [TaxId:879] [189348] (1 PDB entry)

8. Domain d2wfba1: 2wfb A:4-120 [169300]
   Other proteins in same PDB: d2wfba2
   automated match to d1rdua_
   complexed with act, po4

Details for d2wfba1

PDB Entry: 2wfb, 2 Å

PDB Description: high resolution structure of the apo form of the orange protein (orp) from desulfovibrio gigas

PDB Compounds: (A:) putative uncharacterized protein orp

SCOPe Domain Sequences for d2wfba1:

Sequence; same for both SEQRES and ATOM records:

>d2wfba1 c.55.5.0 (A:4-120) automated matches {Desulfovibrio gigas [TaxId: 879]}
mqriavtaegpgldglvdprfgraagfvvvdaatmaaeyvdngasqtlshgaginaaqvl
aksgagvlltgyvgpkafqalqaagikvgqdlegltvrqavqrfldgqvpmaagpnk

Timeline for d2wfba1:

• d2wfba1 first appeared in SCOPe 2.01, called d2wfba_
  
• d2wfba1 appears in SCOPe 2.07