SCOPe 2.06: Domain d2we6a_: 2we6 A:

Lineage for d2we6a_ (2we6 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (20 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [189172] (2 PDB entries)

8. Domain d2we6a_: 2we6 A: [169270]
   automated match to d1ucha_

Details for d2we6a_

PDB Entry: 2we6, 2.42 Å

PDB Description: crystal structure of plasmodium falciparum ubiquitin carboxyl-terminal hydrolase 3 (uchl3)

PDB Compounds: (A:) ubiquitin carboxyl-terminal hydrolase l3

SCOPe Domain Sequences for d2we6a_:

Sequence, based on SEQRES records:

>d2we6a_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvndnivs
enntndkhnlkenfdnvwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvn
emsaekrgqelknnksienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdh
ptvhcftngdnflydtgkiiqdkfiekckddlrfsalavipndn

Sequence, based on observed residues (ATOM records):

>d2we6a_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvkenfdn
vwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvnemsaekrgqelknnks
ienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdhptvhcftngdnflydt
gkiiqdkfiekckddlrfsalavipndn

Timeline for d2we6a_:

• d2we6a_ first appeared in SCOPe 2.01
  
• d2we6a_ appears in SCOPe 2.05
  
• d2we6a_ appears in SCOPe 2.07
  
• d2we6a_ appears in the current release, SCOPe 2.08