Lineage for d1ffya1 (1ffy A:645-917)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705922Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 2705937Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 2705938Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)
    contains additional alpha+beta and Zn-binding domains in the C-terminal extension
  8. 2705939Domain d1ffya1: 1ffy A:645-917 [16926]
    Other proteins in same PDB: d1ffya2, d1ffya3
    protein/RNA complex; complexed with k, mg, mrc, zn
    has additional subdomain(s) that are not in the common domain

Details for d1ffya1

PDB Entry: 1ffy (more details), 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1ffya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffya1 a.27.1.1 (A:645-917) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdiviehadge
kcercwnysedlgavdelthlcprcqqvvkslv

SCOPe Domain Coordinates for d1ffya1:

Click to download the PDB-style file with coordinates for d1ffya1.
(The format of our PDB-style files is described here.)

Timeline for d1ffya1: