Lineage for d1a8h_1 (1a8h 349-500)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) 
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins) Protein Methionyl-tRNA synthetase (MetRS) [47325] (2 species) Species Thermus thermophilus [TaxId:274] [47326] (1 PDB entry) 
Domain d1a8h_1: 1a8h 349-500 [16922]
Other proteins in same PDB: d1a8h_2
Details for d1a8h_1
PDB Entry: 1a8h (more details), 2 Å
PDB Description: methionyl-trna synthetase from thermus thermophilus
SCOP Domain Sequences for d1a8h_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8h_1 a.27.1.1 (349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk
SCOP Domain Coordinates for d1a8h_1:
Click to download the PDB-style file with coordinates for d1a8h_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8h_1:
- d1a8h_1 appears in SCOP 1.57
- d1a8h_1 appears in the current release, SCOPe 2.08, called d1a8ha1
View in 3D
