SCOPe 2.08: Domain d2wbwa_: 2wbw A:

Lineage for d2wbwa_ (2wbw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein automated matches [190333] (6 species)
   not a true protein

7. Species Human adenovirus 37 [TaxId:52275] [188823] (4 PDB entries)

8. Domain d2wbwa_: 2wbw A: [169195]
   Other proteins in same PDB: d2wbwb_
   automated match to d1uxaa_
   complexed with ca, sia

Details for d2wbwa_

PDB Entry: 2wbw, 1.55 Å

PDB Description: ad37 fibre head in complex with car d1 and sialic acid

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d2wbwa_:

Sequence; same for both SEQRES and ATOM records:

>d2wbwa_ b.21.1.1 (A:) automated matches {Human adenovirus 37 [TaxId: 52275]}
rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
qe

Timeline for d2wbwa_:

• d2wbwa_ first appeared in SCOPe 2.01
  
• d2wbwa_ appears in SCOPe 2.07