Lineage for d2wbvb_ (2wbv B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776959Protein automated matches [190333] (6 species)
    not a true protein
  7. 2776960Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries)
  8. 2776962Domain d2wbvb_: 2wbv B: [169190]
    automated match to d2j1kc1
    complexed with gol, sia

Details for d2wbvb_

PDB Entry: 2wbv (more details), 1.9 Å

PDB Description: canine adenovirus 2 fibre head in complex with sialic acid
PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d2wbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbvb_ b.21.1.1 (B:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
sppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqs
qfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaat
isrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltft
yvgenq

SCOPe Domain Coordinates for d2wbvb_:

Click to download the PDB-style file with coordinates for d2wbvb_.
(The format of our PDB-style files is described here.)

Timeline for d2wbvb_: