Lineage for d2wbld_ (2wbl D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988558Protein automated matches [190047] (13 species)
    not a true protein
  7. 988751Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (6 PDB entries)
  8. 988760Domain d2wbld_: 2wbl D: [169188]
    automated match to d1ds6a_

Details for d2wbld_

PDB Entry: 2wbl (more details), 2.9 Å

PDB Description: three-dimensional structure of a binary rop-prone complex
PDB Compounds: (D:) rac-like GTP-binding protein arac2

SCOPe Domain Sequences for d2wbld_:

Sequence, based on SEQRES records: (download)

>d2wbld_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
arfikcvtvgdgavgktcmlisytgntfptdyvptvfdnfsanvvvdgstvnlglwdtag
qedynrlrplsyrgadvfllafsliskasyenihkkwlpelkhyapgipivlvgtkldlr
ddkqflkdhpgaasittaqgeelrkmigavrylecssktqqnvkavfdtairvalrp

Sequence, based on observed residues (ATOM records): (download)

>d2wbld_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
arfikcvtvgdgavgktcmlisytgptvfdnfsanvvvdgstvnlglwdtagqedynrlr
plsyrgadvfllafsliskasyenihkkwlpelkhyapgipivlvgtkldlrddkqflkd
hpgaasittaqgeelrkmigavrylecssktqqnvkavfdtairvalrp

SCOPe Domain Coordinates for d2wbld_:

Click to download the PDB-style file with coordinates for d2wbld_.
(The format of our PDB-style files is described here.)

Timeline for d2wbld_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wblc_