Lineage for d2wa2b_ (2wa2 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146853Species Modoc virus [TaxId:64300] [189030] (2 PDB entries)
  8. 2146855Domain d2wa2b_: 2wa2 B: [169157]
    automated match to d1l9ka_
    complexed with sam, so4

Details for d2wa2b_

PDB Entry: 2wa2 (more details), 1.8 Å

PDB Description: structure of the methyltransferase domain from modoc virus, a flavivirus with no known vector (nkv)
PDB Compounds: (B:) non-structural protein 5

SCOPe Domain Sequences for d2wa2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wa2b_ c.66.1.0 (B:) automated matches {Modoc virus [TaxId: 64300]}
tlgeiwkrklnqldakefmayrrrfvvevdrnearealakgktntghavsrgtaklawid
erggvelkgtvvdlgcgrgswsyyaasqpnvrevkaytlgtsghekprlvetfgwnlitf
kskvdvtkmepfqadtvlcdigesnptaaveasrtltvlnvisrwleynqgcgfcvkvln
pyscdvlealmkmqarfggglirvplsrnsthemyfvsgiknnimgnvtavsrqllkrme
eqggervvpdykfstgtrs

SCOPe Domain Coordinates for d2wa2b_:

Click to download the PDB-style file with coordinates for d2wa2b_.
(The format of our PDB-style files is described here.)

Timeline for d2wa2b_: