Lineage for d2w9ra_ (2w9r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946590Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2946591Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2946615Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 2946636Protein automated matches [190034] (3 species)
    not a true protein
  7. 2946647Species Escherichia coli K-12 [TaxId:83333] [188884] (2 PDB entries)
  8. 2946648Domain d2w9ra_: 2w9r A: [169144]
    automated match to d1lzwa_

Details for d2w9ra_

PDB Entry: 2w9r (more details), 1.7 Å

PDB Description: structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps
PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d2w9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9ra_ d.45.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgka
icgvftaevaetkvamvnkyarenehpllctlekaga

SCOPe Domain Coordinates for d2w9ra_:

Click to download the PDB-style file with coordinates for d2w9ra_.
(The format of our PDB-style files is described here.)

Timeline for d2w9ra_: