SCOPe 2.02: Domain d2w9lx_: 2w9l X:

Lineage for d2w9lx_ (2w9l X:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)

8. Domain d2w9lx_: 2w9l X: [169141]
   Other proteins in same PDB: d2w9lc_, d2w9ld_, d2w9le_, d2w9lf_, d2w9lh_, d2w9li_, d2w9ll_, d2w9lm_, d2w9ln_, d2w9lq_, d2w9lr_, d2w9ls_
   automated match to d1eaja_

Details for d2w9lx_

PDB Entry: 2w9l, 2.91 Å

PDB Description: canine adenovirus type 2 fibre head in complex with car domain d1 and sialic acid

PDB Compounds: (X:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2w9lx_:

Sequence; same for both SEQRES and ATOM records:

>d2w9lx_ b.1.1.1 (X:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
vlv

Timeline for d2w9lx_:

• d2w9lx_ first appeared in SCOPe 2.01
  
• d2w9lx_ appears in SCOPe 2.03
  
• d2w9lx_ appears in the current release, SCOPe 2.08