Lineage for d2w9lv_ (2w9l V:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929469Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 929470Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 929484Domain d2w9lv_: 2w9l V: [169140]
    Other proteins in same PDB: d2w9lc_, d2w9ld_, d2w9le_, d2w9lf_, d2w9lh_, d2w9li_, d2w9ll_, d2w9lm_, d2w9ln_, d2w9lq_, d2w9lr_, d2w9ls_
    automated match to d1eaja_

Details for d2w9lv_

PDB Entry: 2w9l (more details), 2.91 Å

PDB Description: canine adenovirus type 2 fibre head in complex with car domain d1 and sialic acid
PDB Compounds: (V:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2w9lv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9lv_ b.1.1.1 (V:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
v

SCOPe Domain Coordinates for d2w9lv_:

Click to download the PDB-style file with coordinates for d2w9lv_.
(The format of our PDB-style files is described here.)

Timeline for d2w9lv_: