Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries) |
Domain d2w8ya_: 2w8y A: [169112] automated match to d1a28a_ complexed with 486, edo, ndr, so4 |
PDB Entry: 2w8y (more details), 1.8 Å
SCOPe Domain Sequences for d2w8ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w8ya_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila gmvkpllfhkk
Timeline for d2w8ya_: