SCOPe 2.06: Domain d2w72c_: 2w72 C:

Lineage for d2w72c_ (2w72 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188371] (6 PDB entries)

8. Domain d2w72c_: 2w72 C: [169085]
   Other proteins in same PDB: d2w72b_, d2w72d_
   automated match to d1j7sa_
   complexed with hem, k, po4, so4, xe; mutant

Details for d2w72c_

PDB Entry: 2w72, 1.07 Å

PDB Description: deoxygenated structure of a distal site hemoglobin mutant plus xe

PDB Compounds: (C:) human hemoglobin a

SCOPe Domain Sequences for d2w72c_:

Sequence; same for both SEQRES and ATOM records:

>d2w72c_ a.1.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d2w72c_:

• d2w72c_ first appeared in SCOPe 2.01
  
• d2w72c_ appears in SCOPe 2.05
  
• d2w72c_ appears in SCOPe 2.07
  
• d2w72c_ appears in the current release, SCOPe 2.08