Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188371] (6 PDB entries) |
Domain d2w72c_: 2w72 C: [169085] Other proteins in same PDB: d2w72b_, d2w72d_ automated match to d1j7sa_ complexed with hem, k, po4, so4, xe; mutant |
PDB Entry: 2w72 (more details), 1.07 Å
SCOPe Domain Sequences for d2w72c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w72c_ a.1.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d2w72c_: