Lineage for d2w6xa_ (2w6x A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903758Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (4 PDB entries)
  8. 903760Domain d2w6xa_: 2w6x A: [169082]
    automated match to d1dxca_
    complexed with hem, so4, xe; mutant

Details for d2w6xa_

PDB Entry: 2w6x (more details), 1.73 Å

PDB Description: crystal structure of sperm whale myoglobin mutant yqrf in complex with xenon
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2w6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w6xa_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikyleffseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2w6xa_:

Click to download the PDB-style file with coordinates for d2w6xa_.
(The format of our PDB-style files is described here.)

Timeline for d2w6xa_: