SCOPe 2.08: Domain d2w43b_: 2w43 B:

Lineage for d2w43b_ (2w43 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [188720] (2 PDB entries)

8. Domain d2w43b_: 2w43 B: [169050]
   automated match to d1juda_
   complexed with mes, po4

Details for d2w43b_

PDB Entry: 2w43, 1.66 Å

PDB Description: structure of l-haloacid dehalogenase from s. tokodaii

PDB Compounds: (B:) hypothetical 2-haloalkanoic acid dehalogenase

SCOPe Domain Sequences for d2w43b_:

Sequence; same for both SEQRES and ATOM records:

>d2w43b_ c.108.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
iilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgees
kfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifsa
esvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpigg
kpdvivndfkelyewilryk

Timeline for d2w43b_:

• d2w43b_ first appeared in SCOPe 2.01
  
• d2w43b_ appears in SCOPe 2.07