Lineage for d2vyrc_ (2vyr C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735362Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 1735363Protein automated matches [190960] (1 species)
    not a true protein
  7. 1735364Species Human (Homo sapiens) [TaxId:9606] [188578] (10 PDB entries)
  8. 1735379Domain d2vyrc_: 2vyr C: [168935]
    Other proteins in same PDB: d2vyre_, d2vyrf_, d2vyrg_, d2vyrh_, d2vyri_, d2vyrj_, d2vyrk_, d2vyrl_
    automated match to d1ycqa_
    complexed with so4

Details for d2vyrc_

PDB Entry: 2vyr (more details), 2 Å

PDB Description: Structure of human MDM4 N-terminal domain bound to a single domain antibody
PDB Compounds: (C:) mdm4 protein

SCOPe Domain Sequences for d2vyrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyrc_ a.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
lgrqsfsvkdpsplydmlrknlvtla

SCOPe Domain Coordinates for d2vyrc_:

Click to download the PDB-style file with coordinates for d2vyrc_.
(The format of our PDB-style files is described here.)

Timeline for d2vyrc_: