Lineage for d2vxti_ (2vxt I:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061773Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2061836Protein automated matches [190999] (1 species)
    not a true protein
  7. 2061837Species Human (Homo sapiens) [TaxId:9606] [188735] (17 PDB entries)
  8. 2061838Domain d2vxti_: 2vxt I: [168924]
    Other proteins in same PDB: d2vxtl1, d2vxtl2
    automated match to d1j0sa_
    complexed with cl, mg

Details for d2vxti_

PDB Entry: 2vxt (more details), 1.49 Å

PDB Description: crystal structure of human il-18 complexed to murine reference antibody 125-2h fab
PDB Compounds: (I:) Interleukin-18

SCOPe Domain Sequences for d2vxti_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxti_ b.42.1.2 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdardnaprtifiismykdsqprgm
avtisvkaekistlsaenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflaaekerdlfklilkkedelgdrsimftvqne

SCOPe Domain Coordinates for d2vxti_:

Click to download the PDB-style file with coordinates for d2vxti_.
(The format of our PDB-style files is described here.)

Timeline for d2vxti_: