Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein automated matches [190999] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188735] (14 PDB entries) |
Domain d2vxti_: 2vxt I: [168924] Other proteins in same PDB: d2vxtl1, d2vxtl2 automated match to d1j0sa_ complexed with cl, mg |
PDB Entry: 2vxt (more details), 1.49 Å
SCOPe Domain Sequences for d2vxti_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxti_ b.42.1.2 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} yfgklesklsvirnlndqvlfidqgnrplfedmtdsdardnaprtifiismykdsqprgm avtisvkaekistlsaenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy egyflaaekerdlfklilkkedelgdrsimftvqne
Timeline for d2vxti_: