SCOPe 2.04: Domain d2vxqa_: 2vxq A:

Lineage for d2vxqa_ (2vxq A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.3: PHL pollen allergen [49590] (2 families)

5. Family b.7.3.1: PHL pollen allergen [49591] (3 proteins)
   automatically mapped to Pfam PF01357

6. Protein automated matches [191014] (1 species)
   not a true protein

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [188781] (1 PDB entry)

8. Domain d2vxqa_: 2vxq A: [168923]
   Other proteins in same PDB: d2vxql1, d2vxql2
   automated match to d1bmwa_

Details for d2vxqa_

PDB Entry: 2vxq, 1.9 Å

PDB Description: crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab

PDB Compounds: (A:) pollen allergen phl p 2

SCOPe Domain Sequences for d2vxqa_:

Sequence; same for both SEQRES and ATOM records:

>d2vxqa_ b.7.3.1 (A:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
kvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseeplqg
pfnfrfltekgmknvfddvvpekytigatyap

Timeline for d2vxqa_:

• d2vxqa_ first appeared in SCOPe 2.01
  
• d2vxqa_ appears in SCOPe 2.03
  
• d2vxqa_ appears in SCOPe 2.05
  
• d2vxqa_ appears in the current release, SCOPe 2.08