SCOPe 2.06: Domain d2vwtb_: 2vwt B:

Lineage for d2vwtb_ (2vwt B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families)

5. Family c.1.12.0: automated matches [191427] (1 protein)
   not a true family

6. Protein automated matches [190614] (15 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188593] (2 PDB entries)

8. Domain d2vwtb_: 2vwt B: [168890]
   automated match to d1dxea_
   complexed with gol, mg, po4, pyr

Details for d2vwtb_

PDB Entry: 2vwt, 1.93 Å

PDB Description: crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex

PDB Compounds: (B:) yfau, 2-keto-3-deoxy sugar aldolase

SCOPe Domain Sequences for d2vwtb_:

Sequence; same for both SEQRES and ATOM records:

>d2vwtb_ c.1.12.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnallsnpfkerlrkgevqiglwlssttaymaeiaatsgydwllidgehapntiqdlyhq
lqavapyasqpvirpvegskplikqvldigaqtllipmvdtaeqarqvvsatryppyger
gvgasvaraarwgrienymaqvndslcllvqvesktaldnldeildvegidgvfigpadl
saslgypdnaghpevqriietsirriraagkaagflavapdmaqqclawganfvavgvdt
mlysdaldqrlamfks

Timeline for d2vwtb_:

• d2vwtb_ first appeared in SCOPe 2.01
  
• d2vwtb_ appears in SCOPe 2.05
  
• d2vwtb_ appears in SCOPe 2.07
  
• d2vwtb_ appears in the current release, SCOPe 2.08