Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188810] (1 PDB entry) |
Domain d2vu5a_: 2vu5 A: [168827] automated match to d1jxva_ |
PDB Entry: 2vu5 (more details), 2 Å
SCOPe Domain Sequences for d2vu5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vu5a_ d.58.6.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mektflmvkpdgvqrafigeivarfekkgfqlvgaklmqvtpeiagqhyaeheekpffge lvdfitsgpvfamvwqgegvvdtarnmmgktrpheaapgtirgdfgvtvakniihgsdsl esaereigiffkeeelvdysklmnewiy
Timeline for d2vu5a_: