Lineage for d1exza_ (1exz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705702Protein Stem cell factor, SCF [47299] (1 species)
    forms dimer similar to the M-CSF and Flt3 ligand dimers
  7. 2705703Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries)
  8. 2705708Domain d1exza_: 1exz A: [16877]
    complexed with ca, sm, trs

Details for d1exza_

PDB Entry: 1exz (more details), 2.3 Å

PDB Description: structure of stem cell factor
PDB Compounds: (A:) stem cell factor

SCOPe Domain Sequences for d1exza_:

Sequence, based on SEQRES records: (download)

>d1exza_ a.26.1.2 (A:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
crnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkf
sniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsi
dafkdfvvasetsdcv

Sequence, based on observed residues (ATOM records): (download)

>d1exza_ a.26.1.2 (A:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
crnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkf
sniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsi
dafkdfvvasdcv

SCOPe Domain Coordinates for d1exza_:

Click to download the PDB-style file with coordinates for d1exza_.
(The format of our PDB-style files is described here.)

Timeline for d1exza_: