Lineage for d2voab_ (2voa B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988256Species Archaeoglobus fulgidus [TaxId:2234] [188717] (1 PDB entry)
  8. 2988258Domain d2voab_: 2voa B: [168747]
    automated match to d1akoa_

Details for d2voab_

PDB Entry: 2voa (more details), 1.7 Å

PDB Description: structure of an ap endonuclease from archaeoglobus fulgidus
PDB Compounds: (B:) exodeoxyribonuclease III

SCOPe Domain Sequences for d2voab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voab_ d.151.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mlkiatfnvnsirsrlhivipwlkenkpdilcmqetkvenrkfpeadfhrigyhvvfsgs
kgrngvaiasleepedvsfgldsepkdedrlirakiagidvintyvpqgfkidsekyqyk
lqwlerlyhylqktvdfrsfavwcgdmnvapepidvhspdklknhvcfhedarraykkil
elgfvdvlrkihpneriytfydyrvkgaierglgwrgdailatpplaercvdcyadikpr
laekpsdhlplvavfdv

SCOPe Domain Coordinates for d2voab_:

Click to download the PDB-style file with coordinates for d2voab_.
(The format of our PDB-style files is described here.)

Timeline for d2voab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2voaa_