Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
Protein automated matches [190734] (14 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [188717] (1 PDB entry) |
Domain d2voab_: 2voa B: [168747] automated match to d1akoa_ |
PDB Entry: 2voa (more details), 1.7 Å
SCOPe Domain Sequences for d2voab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2voab_ d.151.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mlkiatfnvnsirsrlhivipwlkenkpdilcmqetkvenrkfpeadfhrigyhvvfsgs kgrngvaiasleepedvsfgldsepkdedrlirakiagidvintyvpqgfkidsekyqyk lqwlerlyhylqktvdfrsfavwcgdmnvapepidvhspdklknhvcfhedarraykkil elgfvdvlrkihpneriytfydyrvkgaierglgwrgdailatpplaercvdcyadikpr laekpsdhlplvavfdv
Timeline for d2voab_: