Lineage for d2vo2x_ (2vo2 X:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741620Protein automated matches [190089] (9 species)
    not a true protein
  7. 1741673Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)
  8. 1741689Domain d2vo2x_: 2vo2 X: [168743]
    automated match to d1oafa_
    complexed with hem, na, so4; mutant

Details for d2vo2x_

PDB Entry: 2vo2 (more details), 1.9 Å

PDB Description: crystal structure of soybean ascorbate peroxidase mutant w41a subjected to low dose x-rays
PDB Compounds: (X:) ascorbate peroxidase

SCOPe Domain Sequences for d2vo2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo2x_ a.93.1.1 (X:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d2vo2x_:

Click to download the PDB-style file with coordinates for d2vo2x_.
(The format of our PDB-style files is described here.)

Timeline for d2vo2x_: