Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries) |
Domain d2vn9b_: 2vn9 B: [168729] automated match to d1a06a_ complexed with cl, epe, gvd, po4 |
PDB Entry: 2vn9 (more details), 2.3 Å
SCOPe Domain Sequences for d2vn9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vn9b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smtdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrll khpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhch lngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrk dpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdl inkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrklkgailttm l
Timeline for d2vn9b_: