Lineage for d2vl6a_ (2vl6 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1125613Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1125614Protein automated matches [190576] (6 species)
    not a true protein
  7. 1125634Species Sulfolobus solfataricus [TaxId:2287] [188424] (1 PDB entry)
  8. 1125635Domain d2vl6a_: 2vl6 A: [168676]
    automated match to d1ltle_
    complexed with zn

Details for d2vl6a_

PDB Entry: 2vl6 (more details), 2.8 Å

PDB Description: structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain
PDB Compounds: (A:) minichromosome maintenance protein mcm

SCOPe Domain Sequences for d2vl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vl6a_ b.40.4.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
qidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinn
tkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgi
lvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipek
tklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvk
rgsravfdiymkvssievs

SCOPe Domain Coordinates for d2vl6a_:

Click to download the PDB-style file with coordinates for d2vl6a_.
(The format of our PDB-style files is described here.)

Timeline for d2vl6a_: