SCOPe 2.07: Domain d1itma_: 1itm A:

Lineage for d1itma_ (1itm A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries)

8. Domain d1itma_: 1itm A: [16858]

Details for d1itma_

PDB Entry: 1itm

PDB Description: analysis of the solution structure of human interleukin 4 determined by heteronuclear three-dimensional nuclear magnetic resonance techniques

PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d1itma_:

Sequence; same for both SEQRES and ATOM records:

>d1itma_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
mhkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshh
ekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlkti
mrekyskcss

Timeline for d1itma_:

• d1itma_ first appeared (with stable ids) in SCOP 1.55, called d1itm__
  
• d1itma_ appears in SCOPe 2.06
  
• d1itma_ appears in the current release, SCOPe 2.08, called d1itma1