Lineage for d2vgga3 (2vgg A:440-573)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135454Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2135455Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2135456Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2135457Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2135478Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries)
  8. 2135487Domain d2vgga3: 2vgg A:440-573 [168566]
    Other proteins in same PDB: d2vgga1, d2vgga2, d2vggb1, d2vggb2, d2vggc1, d2vggc2, d2vggd1, d2vggd2
    complexed with fbp, k, mn, pga; mutant

Details for d2vgga3

PDB Entry: 2vgg (more details), 2.74 Å

PDB Description: human erythrocyte pyruvate kinase: r479h mutant
PDB Compounds: (A:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgga3 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttghsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOPe Domain Coordinates for d2vgga3:

Click to download the PDB-style file with coordinates for d2vgga3.
(The format of our PDB-style files is described here.)

Timeline for d2vgga3: