Lineage for d2vgfb2 (2vgf B:57-159,B:262-439)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100062Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2100063Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2100084Species Human (Homo sapiens) [TaxId:9606] [82273] (8 PDB entries)
  8. 2100103Domain d2vgfb2: 2vgf B:57-159,B:262-439 [168556]
    Other proteins in same PDB: d2vgfa1, d2vgfa3, d2vgfb1, d2vgfb3, d2vgfc1, d2vgfc3, d2vgfd1, d2vgfd3
    complexed with fbp, k, mn, pga; mutant

Details for d2vgfb2

PDB Entry: 2vgf (more details), 2.75 Å

PDB Description: human erythrocyte pyruvate kinase: t384m mutant
PDB Compounds: (B:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgfb2 c.1.12.1 (B:57-159,B:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgve
hgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvar
gdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavld
gadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

SCOPe Domain Coordinates for d2vgfb2:

Click to download the PDB-style file with coordinates for d2vgfb2.
(The format of our PDB-style files is described here.)

Timeline for d2vgfb2: