SCOPe 2.08: Domain d2vg1a_: 2vg1 A:

Lineage for d2vg1a_ (2vg1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188255] (3 PDB entries)

8. Domain d2vg1a_: 2vg1 A: [168538]
   automated match to d1f75a_
   complexed with fpp, gol, po4

Details for d2vg1a_

PDB Entry: 2vg1, 1.7 Å

PDB Description: rv1086 e,e-farnesyl diphosphate complex

PDB Compounds: (A:) short-chain z-isoprenyl diphosphate synthetase

SCOPe Domain Sequences for d2vg1a_:

Sequence; same for both SEQRES and ATOM records:

>d2vg1a_ c.101.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sdlprhiavlcdgnrrwarsagyddvsygyrmgaakiaemlrwcheagielatvyllste
nlqrdpdelaalieiitdvveeicapanhwsvrtvgdlgligeeparrlrgavestpeva
sfhvnvavgyggrreivdavrallskelangataeelvdavtvegisenlytsgqpdpdl
virtsgeqrlsgfllwqsaysemwfteahwpafrhvdflralrdysar

Timeline for d2vg1a_:

• d2vg1a_ first appeared in SCOPe 2.01
  
• d2vg1a_ appears in SCOPe 2.07