Lineage for d2vdhm_ (2vdh M:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419773Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1419774Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1419775Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1419776Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1419795Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 1419820Domain d2vdhm_: 2vdh M: [168468]
    Other proteins in same PDB: d2vdha1, d2vdha2, d2vdhb1, d2vdhb2, d2vdhc1, d2vdhc2, d2vdhd1, d2vdhd2, d2vdhe1, d2vdhe2, d2vdhf1, d2vdhf2, d2vdhg1, d2vdhg2, d2vdhh1, d2vdhh2
    automated match to d2v63i1
    complexed with cap, edo, mg; mutant

Details for d2vdhm_

PDB Entry: 2vdh (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
PDB Compounds: (M:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2vdhm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdhm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2vdhm_:

Click to download the PDB-style file with coordinates for d2vdhm_.
(The format of our PDB-style files is described here.)

Timeline for d2vdhm_: