SCOPe 2.04: Domain d2vcsa_: 2vcs A:

Lineage for d2vcsa_ (2vcs A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (7 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)

8. Domain d2vcsa_: 2vcs A: [168462]
   automated match to d1oafa_
   complexed with hem, isz, so4; mutant

Details for d2vcsa_

PDB Entry: 2vcs, 1.68 Å

PDB Description: structure of isoniazid (inh) bound to cytosolic soybean ascorbate peroxidase mutant h42a

PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2vcsa_:

Sequence; same for both SEQRES and ATOM records:

>d2vcsa_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawasagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

Timeline for d2vcsa_:

• d2vcsa_ first appeared in SCOPe 2.01
  
• d2vcsa_ appears in SCOPe 2.03
  
• d2vcsa_ appears in SCOPe 2.05
  
• d2vcsa_ appears in the current release, SCOPe 2.08