Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
Protein automated matches [190045] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries) |
Domain d2vaca1: 2vac A:6-137 [168425] Other proteins in same PDB: d2vaca2 automated match to d1m4ja_ complexed with edo, zn |
PDB Entry: 2vac (more details), 1.7 Å
SCOPe Domain Sequences for d2vaca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vaca1 d.109.1.2 (A:6-137) automated matches {Human (Homo sapiens) [TaxId: 9606]} gihateelkeffakaragsvrlikvviedeqlvlgasqepvgrwdqdydravlplldaqq pcyllyrldsqnaqgfewlflawspdnspvrlkmlyaatratvkkefggghikdelfgtv kddlsfagyqkh
Timeline for d2vaca1: