Lineage for d2vaca1 (2vac A:6-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969863Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2969916Protein automated matches [190045] (5 species)
    not a true protein
  7. 2969926Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)
  8. 2969930Domain d2vaca1: 2vac A:6-137 [168425]
    Other proteins in same PDB: d2vaca2
    automated match to d1m4ja_
    complexed with edo, zn

Details for d2vaca1

PDB Entry: 2vac (more details), 1.7 Å

PDB Description: structure of n-terminal actin depolymerizing factor homology (adf-h) domain of human twinfilin-2
PDB Compounds: (A:) twinfilin-2

SCOPe Domain Sequences for d2vaca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaca1 d.109.1.2 (A:6-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gihateelkeffakaragsvrlikvviedeqlvlgasqepvgrwdqdydravlplldaqq
pcyllyrldsqnaqgfewlflawspdnspvrlkmlyaatratvkkefggghikdelfgtv
kddlsfagyqkh

SCOPe Domain Coordinates for d2vaca1:

Click to download the PDB-style file with coordinates for d2vaca1.
(The format of our PDB-style files is described here.)

Timeline for d2vaca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vaca2