Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188042] (7 PDB entries) |
Domain d2v9tb_: 2v9t B: [168412] Other proteins in same PDB: d2v9ta_ automated match to d1w8aa_ |
PDB Entry: 2v9t (more details), 1.7 Å
SCOPe Domain Sequences for d2v9tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9tb_ c.10.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn pietsgarctsprrlankrigqikskkfrc
Timeline for d2v9tb_: